LL-37 5mg

LL-37 Peptide 5mg – Premium Research Grade

LL-37 is a highly specialised research peptide developed for advanced scientific exploration in immunology, microbiology, and related fields. Supplied in a 5mg lyophilised format, it offers exceptional purity, stability, and consistency for professional laboratory environments.

Product Specifications

• Product Name: LL-37 Peptide 5mg

• Catalogue Number: LL37-5mg

• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃

• Molecular Weight: 4493.3 g/mol

• Purity: ≥98%

• Sequence: [LL-37, 37 aa]

• Form: Lyophilised (freeze-dried) solid

Key Features

• High research-grade purity (≥98%)

• Precision synthesis for consistent, reliable results

• Lyophilised format for enhanced stability and shelf life

• Suitable for advanced laboratory and analytical applications

Storage & Handling

• Supplied as a stable lyophilised solid

• Store under recommended cold conditions to preserve integrity

• Reconstitute following professional laboratory protocols

Quality & Manufacturing

At Versai Peptides, quality is at the core of every product. LL-37 is produced using a controlled synthesis process and undergoes rigorous quality control to ensure:

• Exceptional purity and structural accuracy

• Reliable performance in research settings

• Consistency across every production batch

Regulatory Notice

• For research use only

• Not for human consumption or therapeutic use

• Intended strictly for controlled laboratory environments